Veridian Research

Compare · Research-Use-Only

BPC-157 vs TB-500

The most commonly paired compounds in tissue-repair research, and the most commonly conflated. BPC-157 is a 15-amino-acid sequence derived from a gastric protein; TB-500 is a synthetic fragment of thymosin beta-4, not the full protein. Their mechanisms are distinct: BPC-157 acts largely through growth factor and nitric oxide pathways, while thymosin beta-4 sequesters actin and influences cell migration.

Spec
BPC-157
TB-500
Class
Synthetic peptide
Molecular weight
1419.53 Da
4963.4 Da (full-length thymosin beta-4)
Sequence
Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Purity
>=99%
99%+ HPLC
Form
Lyophilized powder
Lyophilized powder
CAS number
137525-51-0

BPC-157

BPC-157 (Body Protection Compound-157) is a synthetic pentadecapeptide derived from a conserved sequence within the human gastric juice protein BPC. Its remarkable stability in gastric acid, plasma, and tissue environments (hence 'stable gastric pentadecapeptide') sets it apart from most endogenous peptides. While the precise receptor has not been definitively identified, multiple mechanistic pathways have been proposed and characterized in preclinical models. BPC-157 upregulates vascular endothelial growth factor receptor 2 (VEGFR2) and promotes angiogenesis, which may underlie its wound-healing effects in tendon, ligament, and muscle tissue. It modulates nitric oxide (NO) production through interactions with both constitutive (eNOS, nNOS) and inducible (iNOS) nitric oxide synthase isoforms — with context-dependent effects that help restore vascular homeostasis. BPC-157 activates focal adhesion kinase (FAK) and paxillin — proteins critical for cell migration, adhesion, and survival — which may explain its promotion of fibroblast and keratinocyte migration in wound models. It also interacts with the GABA-B receptor system, and preclinical data suggest modulation of dopaminergic and serotonergic pathways. In gastrointestinal research, BPC-157 protects gastric mucosa by suppressing NF-κB, reducing oxidative stress, and maintaining mucosal integrity. It is notable that BPC-157 is active at very low doses (nanogram range) in most preclinical models. All mechanistic and efficacy data are currently from preclinical studies; no completed human clinical trials exist.

TB-500

Thymosin beta-4 is the principal intracellular G-actin sequestering peptide in eukaryotic cells. It binds monomeric G-actin in a 1:1 stoichiometry through a conserved actin-binding motif, maintaining a cytoplasmic reservoir of polymerization-competent actin and thereby buffering the G-actin/F-actin equilibrium that governs cytoskeletal remodeling and cell motility. An important identity distinction applies to this compound: peer-reviewed analytical work has characterized the material supplied as TB-500 as the N-terminal acetylated 17-23 fragment of thymosin beta-4 (Ac-LKKTETQ), not the intact 43-residue protein, and essentially all of the biology summarized here was generated with full-length thymosin beta-4. Beyond its canonical intracellular role, the full-length peptide is released extracellularly at sites of tissue injury, where it has been reported to influence endothelial cell migration, angiogenic tube formation, and inflammatory signaling. In cardiac tissue, Bock-Marquette and colleagues reported that thymosin beta-4 forms a functional complex with PINCH and integrin-linked kinase, activating ILK and downstream Akt signaling. The peptide is unstructured in free solution and adopts partial helical character upon binding actin, a conformational feature typical of the beta-thymosin family. Its small size and lack of stable tertiary structure make it a substrate for exopeptidase processing, generating shorter fragments including the N-terminal Ac-SDKP tetrapeptide, which has its own documented activity in the literature. Mechanistic work on the isolated 17-23 actin-binding fragment is substantially thinner than for the intact 43-mer.

Other research peptide comparisons

Both compounds in stock at Veridian. 99%+ HPLC purity, same-day US shipping.

Browse all research peptides →