Skip to content
Veridian Research

Comparison. Research use only.

BPC-157 vs TB-500

The most commonly paired compounds in tissue-repair research, and the most commonly conflated. BPC-157 is a 15-amino-acid sequence derived from a gastric protein; TB-500 is a synthetic fragment of thymosin beta-4, not the full protein. Their mechanisms are distinct: BPC-157 acts largely through growth factor and nitric oxide pathways, while thymosin beta-4 sequesters actin and influences cell migration.

Spec
BPC-157
TB-500
Class
Synthetic peptide
Not listed
Molecular weight
1419.53 Da
4963.4 Da (full-length parent protein)
Sequence
Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Purity
>=99%
99%+ HPLC
Form
Lyophilized powder
Lyophilized powder
CAS number
137525-51-0
Not listed

BPC-157

BPC-157 (Body Protection Compound-157) is a synthetic pentadecapeptide, a chain of 15 amino acids, taken from a conserved sequence within the human gastric juice protein BPC. It is unusually stable in gastric acid, plasma, and tissue (hence the name 'stable gastric pentadecapeptide'), which sets it apart from most endogenous peptides. The precise receptor has not been definitively identified. Several mechanistic pathways have been proposed and characterized in preclinical models. BPC-157 upregulates vascular endothelial growth factor receptor 2 (VEGFR2) and promotes angiogenesis, the growth of new blood vessels, which may underlie its wound-healing effects in tendon, ligament, and muscle tissue. It also modulates nitric oxide (NO) production through both the constitutive (eNOS, nNOS) and inducible (iNOS) nitric oxide synthase isoforms, with context-dependent effects that help restore vascular homeostasis. BPC-157 activates focal adhesion kinase (FAK) and paxillin, two proteins critical for cell migration, adhesion, and survival. That may explain why it promotes fibroblast and keratinocyte migration in wound models. It also interacts with the GABA-B receptor system, and preclinical data suggest modulation of dopaminergic and serotonergic pathways. In gastrointestinal research, BPC-157 protects gastric mucosa by suppressing NF-κB, reducing oxidative stress, and maintaining mucosal integrity. It is notable that BPC-157 is active at very low doses (nanogram range) in most preclinical models. All mechanistic and efficacy data are currently from preclinical studies; no completed human clinical trials exist.

TB-500

The full-length parent protein from which TB-500 is derived is the main peptide inside eukaryotic cells that sequesters G-actin, meaning it holds single actin units in reserve so they are not built into filaments. It binds monomeric G-actin one-to-one through a conserved actin-binding motif. That keeps a cytoplasmic reservoir of actin ready to polymerize and buffers the G-actin/F-actin balance that governs cytoskeletal remodeling and cell movement. An important identity distinction applies to this compound. Peer-reviewed analytical work has characterized the material supplied as TB-500 as the N-terminal acetylated 17-23 fragment of that protein (Ac-LKKTETQ), not the intact 43-residue form. Essentially all of the biology summarized here was generated with the full-length parent. Beyond that role inside the cell, the full-length peptide is released outside cells at sites of tissue injury. There it has been reported to influence endothelial cell migration, angiogenic tube formation, and inflammatory signaling. In cardiac tissue, Bock-Marquette and colleagues reported that the parent peptide forms a functional complex with PINCH and integrin-linked kinase, activating ILK and downstream Akt signaling. The peptide has no fixed shape in free solution and takes on partial helical character when it binds actin, a feature typical of its peptide family. Its small size and lack of stable tertiary structure make it a substrate for exopeptidase processing, which generates shorter fragments including the N-terminal Ac-SDKP tetrapeptide, itself the subject of documented activity in the literature. Mechanistic work on the isolated 17-23 actin-binding fragment is substantially thinner than for the intact 43-mer.

Other research peptide comparisons

Both compounds in stock at Veridian. 99%+ HPLC purity, same-day US shipping.

Browse all research peptides →