Skip to content
Veridian Research

Comparison. Research use only.

Cagrilintide vs Tirzepatide

Two different receptor strategies in metabolic research. Tirzepatide is a dual GIP/GLP-1 incretin agonist characterized across the SURMOUNT program. Cagrilintide is a long-acting amylin analog acting on a separate satiety pathway, which is why the two are studied in combination rather than as substitutes.

Spec
Cagrilintide
Tirzepatide
Class
Synthetic peptide
Synthetic peptide
Molecular weight
4409 g/mol (average)
4813.47 Da
Sequence
KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP (37 aa), C-terminal prolinamide; Cys2-Cys7 disulfide; Lys1 side chain acylated with a C20 diacid via an L-gamma-glutamyl linker
Tyr-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile-Aib-Leu-Asp-Lys(C18 fatty diacid)-Ile-Ala-Gln-Lys-Ala-Phe-Val-Gln-Trp-Leu-Ile-Ala-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
Purity
99%+ HPLC
>=99%
Form
Lyophilized powder
Lyophilized powder
CAS number
1415456-99-3
2023788-19-2

Cagrilintide

Cagrilintide is a lipidated, fibrillation-resistant analogue of human islet amyloid polypeptide (amylin), a 37-residue beta-cell hormone released alongside insulin. The parent hormone clumps readily into amyloid fibrils, which historically made it hard to develop as a drug. Cagrilintide was engineered from a pramlintide-like backbone with three substitutions that suppress fibril formation and stabilize the helical segment, plus acylation of the Lys1 side chain by a C20 diacid through a gamma-glutamyl linker. That fatty diacid gives the peptide reversible, non-covalent binding to albumin, which slows clearance by the kidney and produces pharmacokinetics compatible with the once-weekly subcutaneous administration used in the published trial program. Pharmacologically, cagrilintide is a non-selective agonist at the calcitonin receptor and at the amylin receptors AMY1R, AMY2R and AMY3R. Those amylin receptors are calcitonin-receptor pairings with receptor activity-modifying proteins. Cryo-electron microscopy structures show cagrilintide adopting an amylin-like bypass binding mode across these receptors, with a phenylalanine anchor at the transmembrane bundle and an internal salt bridge stabilizing the peptide helix, while producing conformational dynamics distinct from native amylin. Downstream signalling is predominantly Gs-coupled cAMP accumulation in amylin-responsive nuclei of the hindbrain, notably the area postrema and nucleus tractus solitarius. Rodent knockout work indicates that the effect on body weight depends specifically on AMY1R and AMY3R, rather than on the calcitonin receptor alone. Amylin and GLP-1 receptor signalling converge on partly non-overlapping central circuits, which is why co-administration with semaglutide has been studied as a mechanistically complementary combination.

Tirzepatide

Tirzepatide (LY3298176) is a synthetic dual agonist peptide that activates both the glucagon-like peptide-1 receptor (GLP-1R) and the glucose-dependent insulinotropic polypeptide receptor (GIPR). Structurally, it is a 39-amino acid peptide based on the native GIP sequence, with modifications that let it also activate GLP-1R. A C18 fatty diacid chain is attached through a linker so the peptide binds albumin, the most abundant blood protein. That binding extends plasma half-life to approximately 5 days and allows once-weekly dosing. GLP-1R agonism reduces appetite through hypothalamic and brainstem satiety pathways, slows gastric emptying, and augments glucose-stimulated insulin release from pancreatic beta cells while suppressing glucagon. GIPR agonism complements this by further potentiating insulin secretion in a glucose-dependent manner. It may also modulate adipocyte lipid metabolism, reduce glucagon secretion, and enhance the appetite-suppressing (anorectic) effects of GLP-1R signaling through central GIPR circuits in the hypothalamus and area postrema. Tirzepatide received FDA approval for type 2 diabetes (Mounjaro, May 2022) and obesity (Zepbound, November 2023), making it the first approved dual GLP-1/GIP agonist.

Other research peptide comparisons

Both compounds in stock at Veridian. 99%+ HPLC purity, same-day US shipping.

Browse all research peptides →