Cagrilintide
Available Sizes
Add 1 more for 10% off each
- Shipping protection
- 30-day resolution
- Same-day dispatch
- Visa
- Mastercard
- American Express
- Discover
- Apple Pay
Ships the next business day
Cutoff 3:00 PM ET (12:00 PM PT), Monday to Friday · dispatched from our US facility
Arrives 3–5 business days after dispatch
Free standard shipping over CA$200.00 · about 2 vials of this size
Free express over CA$350.00, 2–4 business days
About 3 vials of this size · selectable at checkout
Duties and import taxes are already paid
All duties and import taxes are included in this price. There is nothing to pay on delivery and the courier will not invoice you at the door.
Third-party tested, lot by lot
Every batch is analysed by an independent laboratory and its certificate is published against the lot number on your vial
Free shipment protection on every order
Lost, stolen or damaged in transit? We replace it, at no cost to you
Description
A long-acting acylated amylin analog that activates amylin and calcitonin receptors to modulate homeostatic signaling research. Studied in preclinical literature for metabolic regulation.
For laboratory research use only. Cagrilintide is supplied as a reference material for in-vitro laboratory research. It is not a drug, food or cosmetic, is not approved for human or veterinary consumption, and must not be used for diagnostic or therapeutic purposes. Handle in accordance with your laboratory's safety protocols.
Specifications
- Molecular Weight
- 4409 g/mol (average)
- Sequence
- KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP (37 aa), C-terminal prolinamide; Cys2-Cys7 disulfide; Lys1 side chain acylated with a C20 diacid via an L-gamma-glutamyl linker
- CAS Number
- 1415456-99-3
- Molecular Formula
- C172H268N48O52S2
- Purity
- 99%+ HPLC
- Form
- Lyophilized powder
- Storage
- Lyophilized: -20C or below, desiccated and protected from light. Equilibrate to room temperature before opening; aliquot reconstituted material and avoid repeated freeze-thaw.
Certificates of analysis
Every batch of Cagrilintide is tested by an independent laboratory. The certificates are also in the gallery at the top of this page.
- View PDF
99.659% purity · Batch 7
Janoshik Analytical · 5mg · Jul 2026
