Skip to content
Veridian Research

Cagrilintide

FromCA$116.99CA$129.99first order with VERIDIAN10, free account·≥99% purity, third-party verified

Available Sizes

5mgVR-CAG-5
In stock
CA$129.9910% at 2

Add 1 more for 10% off each

  • Shipping protection
  • 30-day resolution
  • Same-day dispatch
Accepted
  • Visa
  • Mastercard
  • American Express
  • Discover
  • Apple Pay

Ships the next business day

Cutoff 3:00 PM ET (12:00 PM PT), Monday to Friday · dispatched from our US facility

Arrives 3–5 business days after dispatch

Free standard shipping over CA$200.00 · about 2 vials of this size

Free express over CA$350.00, 2–4 business days

About 3 vials of this size · selectable at checkout

Duties and import taxes are already paid

All duties and import taxes are included in this price. There is nothing to pay on delivery and the courier will not invoice you at the door.

Third-party tested, lot by lot

Every batch is analysed by an independent laboratory and its certificate is published against the lot number on your vial

Free shipment protection on every order

Lost, stolen or damaged in transit? We replace it, at no cost to you

Description

A long-acting acylated amylin analog that activates amylin and calcitonin receptors to modulate homeostatic signaling research. Studied in preclinical literature for metabolic regulation.

For laboratory research use only. Cagrilintide is supplied as a reference material for in-vitro laboratory research. It is not a drug, food or cosmetic, is not approved for human or veterinary consumption, and must not be used for diagnostic or therapeutic purposes. Handle in accordance with your laboratory's safety protocols.

Specifications

Molecular Weight
4409 g/mol (average)
Sequence
KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP (37 aa), C-terminal prolinamide; Cys2-Cys7 disulfide; Lys1 side chain acylated with a C20 diacid via an L-gamma-glutamyl linker
CAS Number
1415456-99-3
Molecular Formula
C172H268N48O52S2
Purity
99%+ HPLC
Form
Lyophilized powder
Storage
Lyophilized: -20C or below, desiccated and protected from light. Equilibrate to room temperature before opening; aliquot reconstituted material and avoid repeated freeze-thaw.

Certificates of analysis

Every batch of Cagrilintide is tested by an independent laboratory. The certificates are also in the gallery at the top of this page.

  • 99.659% purity · Batch 7

    Janoshik Analytical · 5mg · Jul 2026

    View PDF

Continue researching Cagrilintide