TB-500
Available Sizes
Add 1 more for 10% off each
Add 1 more for 10% off each
- Shipping protection
- 30-day resolution
- Same-day dispatch
- Visa
- Mastercard
- American Express
- Discover
- Apple Pay
Ships the next business day
Cutoff 3:00 PM ET (12:00 PM PT), Monday to Friday · dispatched from our US facility
Arrives 3–5 business days after dispatch
Free standard shipping over CA$200.00 · about 3 vials of this size
Free express over CA$350.00, 2–4 business days
About 5 vials of this size · selectable at checkout
Duties and import taxes are already paid
All duties and import taxes are included in this price. There is nothing to pay on delivery and the courier will not invoice you at the door.
Third-party tested, lot by lot
Every batch is analysed by an independent laboratory and its certificate is published against the lot number on your vial
Free shipment protection on every order
Lost, stolen or damaged in transit? We replace it, at no cost to you
Description
Lyophilized powder in a sealed vial. 5mg net content. Third-party HPLC tested, batch certificate published. Ships from the USA. Laboratory research use only.
For laboratory research use only. TB-500 is supplied as a reference material for in-vitro laboratory research. It is not a drug, food or cosmetic, is not approved for human or veterinary consumption, and must not be used for diagnostic or therapeutic purposes. Handle in accordance with your laboratory's safety protocols.
Specifications
- Molecular Weight
- 4963.4 Da (full-length parent protein)
- Sequence
- SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
- Molecular Formula
- C212H350N56O78S
- Purity
- 99%+ HPLC
- Form
- Lyophilized powder
- Storage
- Lyophilized: -20C, desiccated, protected from light. Reconstituted: 2-8C for short-term use; aliquot to avoid repeated freeze-thaw.
Certificates of analysis
Third-party HPLC testing for TB-500 is in progress. The certificate is published here as soon as the laboratory returns it.
Need documentation for a specific lot in the meantime? Contact orders@veridianbio.com with the product name and SKU.
